Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GLRX3 monoclonal antibody (M01), clone 4B5-2A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about GLRX3 monoclonal antibody (M01), clone 4B5-2A8
| Brand: | Abnova |
| Reference: | H00010539-M01 |
| Product name: | GLRX3 monoclonal antibody (M01), clone 4B5-2A8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GLRX3. |
| Clone: | 4B5-2A8 |
| Isotype: | IgG1 kappa |
| Gene id: | 10539 |
| Gene name: | GLRX3 |
| Gene alias: | FLJ11864|GLRX4|GRX3|GRX4|PICOT|TXNL2|TXNL3|bA500G10.4 |
| Gene description: | glutaredoxin 3 |
| Genbank accession: | BC005289 |
| Immunogen: | GLRX3 (AAH05289, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
| Protein accession: | AAH05289 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (62.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GLRX3 monoclonal antibody (M01), clone 4B5-2A8 Western Blot analysis of GLRX3 expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proteomic Analysis in Lung Tissue of Smokers and Chronic Obstructive Pulmonary Disease Patients.Lee EJ, In KH, Kim JH, Lee SY, Shin C, Shim JJ, Kang KH, Yoo SH, Kim CH, Kim HK, Lee SH, Uhm CS. Chest. 2009 Feb;135(2):344-52. Epub 2008 Aug 27. |