Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BATF monoclonal antibody (M03), clone 1G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BATF monoclonal antibody (M03), clone 1G4
| Brand: | Abnova |
| Reference: | H00010538-M03 |
| Product name: | BATF monoclonal antibody (M03), clone 1G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BATF. |
| Clone: | 1G4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10538 |
| Gene name: | BATF |
| Gene alias: | B-ATF|BATF1|SFA-2|SFA2 |
| Gene description: | basic leucine zipper transcription factor, ATF-like |
| Genbank accession: | NM_006399 |
| Immunogen: | BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
| Protein accession: | NP_006390 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | BATF monoclonal antibody (M03), clone 1G4 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A Differentiation Checkpoint Limits Hematopoietic Stem Cell Self-Renewal in Response to DNA Damage.Wang J, Sun Q, Morita Y, Jiang H, GroB A, Lechel A, Hildner K, Guachalla LM, Gompf A, Hartmann D, Schambach A, Wuestefeld T, Dauch D, Schrezenmeier H, Hofmann WK, Nakauchi H, Ju Z, Kestler HA, Zender L, Rudolph KL. Cell. 2012 Mar 2;148(5):1001-1014. Epub 2012 Mar 1. |