Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IPO7 monoclonal antibody (M07), clone 4G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about IPO7 monoclonal antibody (M07), clone 4G6
| Brand: | Abnova |
| Reference: | H00010527-M07 |
| Product name: | IPO7 monoclonal antibody (M07), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IPO7. |
| Clone: | 4G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10527 |
| Gene name: | IPO7 |
| Gene alias: | FLJ14581|Imp7|MGC138673|RANBP7 |
| Gene description: | importin 7 |
| Genbank accession: | NM_006391 |
| Immunogen: | IPO7 (NP_006382.1, 950 a.a. ~ 1038 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN |
| Protein accession: | NP_006382.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IPO7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of IPO7 expression in HeLa(Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Nuclear Extracellular Signal-Regulated Kinase 1 and 2 Translocation Is Mediated by Casein Kinase 2 and Accelerated by Autophosphorylation.Plotnikov A, Chuderland D, Karamansha Y, Livnah O, Seger R. Mol Cell Biol. 2011 Sep;31(17):3515-30. Epub 2011 Jul 5. |