Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HYOU1 monoclonal antibody (M01), clone 6F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about HYOU1 monoclonal antibody (M01), clone 6F7
| Brand: | Abnova |
| Reference: | H00010525-M01 |
| Product name: | HYOU1 monoclonal antibody (M01), clone 6F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HYOU1. |
| Clone: | 6F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10525 |
| Gene name: | HYOU1 |
| Gene alias: | DKFZp686N08236|FLJ94899|FLJ97572|Grp170|HSP12A|ORP150 |
| Gene description: | hypoxia up-regulated 1 |
| Genbank accession: | NM_006389 |
| Immunogen: | HYOU1 (NP_006380, 901 a.a. ~ 999 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL |
| Protein accession: | NP_006380 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HYOU1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Limited expression of reticulocalbin-1 in lymphatic endothelial cells in lung tumor but not in normal lung.Yoshida Y, Yamashita T, Nagano K, Imai S, Nabeshi H, Yoshikawa T, Yoshioka Y, Abe Y, Kamada H, Tsutsumi Y, Tsunoda SI. Biochem Biophys Res Commun. 2011 Jan 25. [Epub ahead of print] |