Brand: | Abnova |
Reference: | H00010522-M11 |
Product name: | DEAF1 monoclonal antibody (M11), clone 3C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DEAF1. |
Clone: | 3C12 |
Isotype: | IgG2a Kappa |
Gene id: | 10522 |
Gene name: | DEAF1 |
Gene alias: | NUDR|SPN|ZMYND5 |
Gene description: | deformed epidermal autoregulatory factor 1 (Drosophila) |
Genbank accession: | NM_021008 |
Immunogen: | DEAF1 (NP_066288.2, 133 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG |
Protein accession: | NP_066288.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DEAF1 monoclonal antibody (M11), clone 3C12. Western Blot analysis of DEAF1 expression in human liver. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |