SEMA4B monoclonal antibody (M03), clone 4B2 View larger

SEMA4B monoclonal antibody (M03), clone 4B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEMA4B monoclonal antibody (M03), clone 4B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SEMA4B monoclonal antibody (M03), clone 4B2

Brand: Abnova
Reference: H00010509-M03
Product name: SEMA4B monoclonal antibody (M03), clone 4B2
Product description: Mouse monoclonal antibody raised against a partial recombinant SEMA4B.
Clone: 4B2
Isotype: IgG2a Kappa
Gene id: 10509
Gene name: SEMA4B
Gene alias: KIAA1745|MGC131831|SEMAC|SemC
Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B
Genbank accession: NM_020210
Immunogen: SEMA4B (NP_064595, 592 a.a. ~ 689 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GEKPCEQVQFQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDEGGSV
Protein accession: NP_064595
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010509-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010509-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SEMA4B is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEMA4B monoclonal antibody (M03), clone 4B2 now

Add to cart