SEMA4B polyclonal antibody (A01) View larger

SEMA4B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEMA4B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SEMA4B polyclonal antibody (A01)

Brand: Abnova
Reference: H00010509-A01
Product name: SEMA4B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SEMA4B.
Gene id: 10509
Gene name: SEMA4B
Gene alias: KIAA1745|MGC131831|SEMAC|SemC
Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B
Genbank accession: NM_020210
Immunogen: SEMA4B (NP_064595, 592 a.a. ~ 689 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GEKPCEQVQFQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDEGGSV
Protein accession: NP_064595
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010509-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SEMA4B polyclonal antibody (A01) now

Add to cart