SEMA4D monoclonal antibody (M01), clone 3B4 View larger

SEMA4D monoclonal antibody (M01), clone 3B4

H00010507-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEMA4D monoclonal antibody (M01), clone 3B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SEMA4D monoclonal antibody (M01), clone 3B4

Brand: Abnova
Reference: H00010507-M01
Product name: SEMA4D monoclonal antibody (M01), clone 3B4
Product description: Mouse monoclonal antibody raised against a partial recombinant SEMA4D.
Clone: 3B4
Isotype: IgG1 Kappa
Gene id: 10507
Gene name: SEMA4D
Gene alias: C9orf164|CD100|FLJ33485|FLJ34282|FLJ39737|FLJ46484|M-sema-G|MGC169138|MGC169141|SEMAJ|coll-4
Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Genbank accession: BC054500
Immunogen: SEMA4D (AAH54500, 115 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSP
Protein accession: AAH54500
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010507-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010507-M01-1-2-1.jpg
Application image note: SEMA4D monoclonal antibody (M01), clone 3B4 Western Blot analysis of SEMA4D expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Phage Display Identification of CD100 in Human Atherosclerotic Plaque Macrophages and Foam Cells.Luque MC, Gutierrez PS, Debbas V, Martins WK, Puech-Leao P, Porto G, Coelho V, Boumsell L, Kalil J, Stolf B
PLoS One. 2013 Sep 30;8(9):e75772. doi: 10.1371/journal.pone.0075772.

Reviews

Buy SEMA4D monoclonal antibody (M01), clone 3B4 now

Add to cart