Brand: | Abnova |
Reference: | H00010495-A01 |
Product name: | ENOX2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ENOX2. |
Gene id: | 10495 |
Gene name: | ENOX2 |
Gene alias: | APK1|COVA1|tNOX |
Gene description: | ecto-NOX disulfide-thiol exchanger 2 |
Genbank accession: | NM_182314 |
Immunogen: | ENOX2 (NP_872114, 309 a.a. ~ 379 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AHEKDMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMG |
Protein accession: | NP_872114 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.92 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |