CRTAP monoclonal antibody (M01), clone 4D9 View larger

CRTAP monoclonal antibody (M01), clone 4D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRTAP monoclonal antibody (M01), clone 4D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about CRTAP monoclonal antibody (M01), clone 4D9

Brand: Abnova
Reference: H00010491-M01
Product name: CRTAP monoclonal antibody (M01), clone 4D9
Product description: Mouse monoclonal antibody raised against a partial recombinant CRTAP.
Clone: 4D9
Isotype: IgG2a Kappa
Gene id: 10491
Gene name: CRTAP
Gene alias: CASP|LEPREL3
Gene description: cartilage associated protein
Genbank accession: NM_006371
Immunogen: CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS
Protein accession: NP_006362
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010491-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010491-M01-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Severe osteogenesis imperfecta in cyclophilin B-deficient mice.Choi JW, Sutor SL, Lindquist L, Evans GL, Madden BJ, Bergen HR 3rd, Hefferan TE, Yaszemski MJ, Bram RJ.
PLoS Genet. 2009 Dec;5(12):e1000750. Epub 2009 Dec 4.

Reviews

Buy CRTAP monoclonal antibody (M01), clone 4D9 now

Add to cart