Brand: | Abnova |
Reference: | H00010491-M01 |
Product name: | CRTAP monoclonal antibody (M01), clone 4D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CRTAP. |
Clone: | 4D9 |
Isotype: | IgG2a Kappa |
Gene id: | 10491 |
Gene name: | CRTAP |
Gene alias: | CASP|LEPREL3 |
Gene description: | cartilage associated protein |
Genbank accession: | NM_006371 |
Immunogen: | CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS |
Protein accession: | NP_006362 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Severe osteogenesis imperfecta in cyclophilin B-deficient mice.Choi JW, Sutor SL, Lindquist L, Evans GL, Madden BJ, Bergen HR 3rd, Hefferan TE, Yaszemski MJ, Bram RJ. PLoS Genet. 2009 Dec;5(12):e1000750. Epub 2009 Dec 4. |