UBE2E3 monoclonal antibody (M05), clone 3E9 View larger

UBE2E3 monoclonal antibody (M05), clone 3E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2E3 monoclonal antibody (M05), clone 3E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about UBE2E3 monoclonal antibody (M05), clone 3E9

Brand: Abnova
Reference: H00010477-M05
Product name: UBE2E3 monoclonal antibody (M05), clone 3E9
Product description: Mouse monoclonal antibody raised against a partial recombinant UBE2E3.
Clone: 3E9
Isotype: IgG2a Kappa
Gene id: 10477
Gene name: UBE2E3
Gene alias: UBCH9|UbcM2
Gene description: ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
Genbank accession: NM_006357
Immunogen: UBE2E3 (NP_006348, 65 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN
Protein accession: NP_006348
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010477-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010477-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged UBE2E3 is approximately 3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBE2E3 monoclonal antibody (M05), clone 3E9 now

Add to cart