Brand: | Abnova |
Reference: | H00010477-M04 |
Product name: | UBE2E3 monoclonal antibody (M04), clone 4C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2E3. |
Clone: | 4C4 |
Isotype: | IgG2a Kappa |
Gene id: | 10477 |
Gene name: | UBE2E3 |
Gene alias: | UBCH9|UbcM2 |
Gene description: | ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) |
Genbank accession: | NM_006357 |
Immunogen: | UBE2E3 (NP_006348, 65 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN |
Protein accession: | NP_006348 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UBE2E3 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |