HMGN4 (Human) Recombinant Protein (P01) View larger

HMGN4 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMGN4 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about HMGN4 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00010473-P01
Product name: HMGN4 (Human) Recombinant Protein (P01)
Product description: Human HMGN4 full-length ORF ( AAH01282, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 10473
Gene name: HMGN4
Gene alias: HMG17L3|MGC5145|NHC
Gene description: high mobility group nucleosomal binding domain 4
Genbank accession: BC001282
Immunogen sequence/protein sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Protein accession: AAH01282
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00010473-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Serine ADP-Ribosylation Depends on HPF1.Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E Zaja R, Ahel I, Matic I.
Mol Cell. 2017 Mar 2;65(5):932-940.e6. doi: 10.1016/j.molcel.2017.01.003. Epub 2017 Feb 9.

Reviews

Buy HMGN4 (Human) Recombinant Protein (P01) now

Add to cart