PIBF1 (Human) Recombinant Protein (Q01) View larger

PIBF1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIBF1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PIBF1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00010464-Q01
Product name: PIBF1 (Human) Recombinant Protein (Q01)
Product description: Human PIBF1 partial ORF ( NP_006337, 660 a.a. - 755 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 10464
Gene name: PIBF1
Gene alias: C13orf24|KIAA1008|PIBF|RP11-505F3.1
Gene description: progesterone immunomodulatory binding factor 1
Genbank accession: NM_006346
Immunogen sequence/protein sequence: EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM
Protein accession: NP_006337
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00010464-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Interleukin-33-induced expression of PIBF1 by decidual B cells protects against preterm labor.Huang B, Faucette AN, Pawlitz MD, Pei B, Goyert JW, Zhou JZ, El-Hage NG, Deng J, Lin J, Yao F, Dewar RS 3rd, Jassal JS, Sandberg ML, Dai J, Cols M, Shen C, Polin LA, Nichols RA, Jones TB, Bluth MH, Puder KS, Gonik B, Nayak NR, Puscheck E, Wei WZ, Cerutti A, Colonna M, Chen K.
Nat Med. 2017 Jan;23(1):128-135. Epub 2016 Dec 5.

Reviews

Buy PIBF1 (Human) Recombinant Protein (Q01) now

Add to cart