Brand: | Abnova |
Reference: | H00010464-Q01 |
Product name: | PIBF1 (Human) Recombinant Protein (Q01) |
Product description: | Human PIBF1 partial ORF ( NP_006337, 660 a.a. - 755 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 10464 |
Gene name: | PIBF1 |
Gene alias: | C13orf24|KIAA1008|PIBF|RP11-505F3.1 |
Gene description: | progesterone immunomodulatory binding factor 1 |
Genbank accession: | NM_006346 |
Immunogen sequence/protein sequence: | EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM |
Protein accession: | NP_006337 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Interleukin-33-induced expression of PIBF1 by decidual B cells protects against preterm labor.Huang B, Faucette AN, Pawlitz MD, Pei B, Goyert JW, Zhou JZ, El-Hage NG, Deng J, Lin J, Yao F, Dewar RS 3rd, Jassal JS, Sandberg ML, Dai J, Cols M, Shen C, Polin LA, Nichols RA, Jones TB, Bluth MH, Puder KS, Gonik B, Nayak NR, Puscheck E, Wei WZ, Cerutti A, Colonna M, Chen K. Nat Med. 2017 Jan;23(1):128-135. Epub 2016 Dec 5. |