CLEC10A (Human) Recombinant Protein View larger

CLEC10A (Human) Recombinant Protein

H00010462-G01_10ug

New product

569,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC10A (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP

More info about CLEC10A (Human) Recombinant Protein

Brand: Abnova
Reference: H00010462-G01
Product name: CLEC10A (Human) Recombinant Protein
Product description: Human CLEC10A full-length ORF (NP_878910.1) recombinant protein without tag.
Gene id: 10462
Gene name: CLEC10A
Gene alias: CD301|CLECSF13|CLECSF14|HML|HML2
Gene description: C-type lectin domain family 10, member A
Genbank accession: NM_182906.2
Immunogen sequence/protein sequence: MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Protein accession: NP_878910.1
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP
Shipping condition: Dry Ice

Reviews

Buy CLEC10A (Human) Recombinant Protein now

Add to cart