Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GPNMB monoclonal antibody (M01), clone 1A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about GPNMB monoclonal antibody (M01), clone 1A8
| Brand: | Abnova |
| Reference: | H00010457-M01 |
| Product name: | GPNMB monoclonal antibody (M01), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GPNMB. |
| Clone: | 1A8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10457 |
| Gene name: | GPNMB |
| Gene alias: | HGFIN|NMB |
| Gene description: | glycoprotein (transmembrane) nmb |
| Genbank accession: | NM_001005340 |
| Immunogen: | GPNMB (NP_001005340, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTL |
| Protein accession: | NP_001005340 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GPNMB is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | GPNMB/OA protein increases the invasiveness of human metastatic prostate cancer cell lines DU145 and PC3 through MMP-2 and MMP-9 activity.Fiorentini C, Bodei S, Bedussi F, Fragni M, Bonini SA, Simeone C, Zani D, Berruti A, Missale C, Memo M, Spano P, Sigala S Exp Cell Res. 2014 Feb 28. pii: S0014-4827(14)00088-3. doi: 10.1016/j.yexcr.2014.02.025. |