Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010456-M04 |
Product name: | HAX1 monoclonal antibody (M04), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HAX1. |
Clone: | 1D2 |
Isotype: | IgG2a Kappa |
Gene id: | 10456 |
Gene name: | HAX1 |
Gene alias: | FLJ17042|FLJ18492|FLJ93803|HCLSBP1|HS1BP1|SCN3 |
Gene description: | HCLS1 associated protein X-1 |
Genbank accession: | NM_006118 |
Immunogen: | HAX1 (NP_006109.2, 76 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWP |
Protein accession: | NP_006109.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HAX1 expression in transfected 293T cell line by HAX1 monoclonal antibody (M04), clone 1D2. Lane 1: HAX1 transfected lysate(31.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |