MAP3K7IP1 monoclonal antibody (M03), clone 2A12 View larger

MAP3K7IP1 monoclonal antibody (M03), clone 2A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K7IP1 monoclonal antibody (M03), clone 2A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce

More info about MAP3K7IP1 monoclonal antibody (M03), clone 2A12

Brand: Abnova
Reference: H00010454-M03
Product name: MAP3K7IP1 monoclonal antibody (M03), clone 2A12
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.
Clone: 2A12
Isotype: IgG1 Kappa
Gene id: 10454
Gene name: MAP3K7IP1
Gene alias: 3'-Tab1|MGC57664|TAB1
Gene description: mitogen-activated protein kinase kinase kinase 7 interacting protein 1
Genbank accession: NM_153497
Immunogen: MAP3K7IP1 (NP_705717.1, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA
Protein accession: NP_705717.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010454-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00010454-M03-1-1-1.jpg
Application image note: MAP3K7IP1 monoclonal antibody (M03), clone 2A12 Western Blot analysis of MAP3K7IP1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy MAP3K7IP1 monoclonal antibody (M03), clone 2A12 now

Add to cart