Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACAA2 monoclonal antibody (M01), clone 5C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about ACAA2 monoclonal antibody (M01), clone 5C4
| Brand: | Abnova |
| Reference: | H00010449-M01 |
| Product name: | ACAA2 monoclonal antibody (M01), clone 5C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACAA2. |
| Clone: | 5C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10449 |
| Gene name: | ACAA2 |
| Gene alias: | DSAEC|FLJ35992|FLJ95265 |
| Gene description: | acetyl-Coenzyme A acyltransferase 2 |
| Genbank accession: | NM_006111 |
| Immunogen: | ACAA2 (NP_006102, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV |
| Protein accession: | NP_006102 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Opposing effects of dietary sugar and saturated fat on cardiovascular risk factors and glucose metabolism in mitochondrially impaired mice.Kuhlow D, Zarse K, Voigt A, Schulz TJ, Petzke KJ, Schomburg L, Pfeiffer AF, Ristow M. Eur J Nutr. 2010 Mar 10. [Epub ahead of print] |