OLFM1 monoclonal antibody (M01), clone 2G12-1B3 View larger

OLFM1 monoclonal antibody (M01), clone 2G12-1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OLFM1 monoclonal antibody (M01), clone 2G12-1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about OLFM1 monoclonal antibody (M01), clone 2G12-1B3

Brand: Abnova
Reference: H00010439-M01
Product name: OLFM1 monoclonal antibody (M01), clone 2G12-1B3
Product description: Mouse monoclonal antibody raised against a full length recombinant OLFM1.
Clone: 2G12-1B3
Isotype: IgG1 kappa
Gene id: 10439
Gene name: OLFM1
Gene alias: AMY|NOE1|NOELIN1|OlfA
Gene description: olfactomedin 1
Genbank accession: BC000189
Immunogen: OLFM1 (AAH00189, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD
Protein accession: AAH00189
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010439-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged OLFM1 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Identification of Novel Brain Biomarkers.Laterza OF, Modur VR, Crimmins DL, Olander JV, Landt Y, Lee JM, Ladenson JH.
Clin Chem. 2006 Sep;52(9):1713-21. Epub 2006 Jul 20.

Reviews

Buy OLFM1 monoclonal antibody (M01), clone 2G12-1B3 now

Add to cart