Brand: | Abnova |
Reference: | H00010439-M01 |
Product name: | OLFM1 monoclonal antibody (M01), clone 2G12-1B3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant OLFM1. |
Clone: | 2G12-1B3 |
Isotype: | IgG1 kappa |
Gene id: | 10439 |
Gene name: | OLFM1 |
Gene alias: | AMY|NOE1|NOELIN1|OlfA |
Gene description: | olfactomedin 1 |
Genbank accession: | BC000189 |
Immunogen: | OLFM1 (AAH00189, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD |
Protein accession: | AAH00189 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged OLFM1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Identification of Novel Brain Biomarkers.Laterza OF, Modur VR, Crimmins DL, Olander JV, Landt Y, Lee JM, Ladenson JH. Clin Chem. 2006 Sep;52(9):1713-21. Epub 2006 Jul 20. |