IFI30 purified MaxPab mouse polyclonal antibody (B01P) View larger

IFI30 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFI30 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about IFI30 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010437-B01P
Product name: IFI30 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IFI30 protein.
Gene id: 10437
Gene name: IFI30
Gene alias: GILT|IFI-30|IP30|MGC32056
Gene description: interferon, gamma-inducible protein 30
Genbank accession: NM_006332
Immunogen: IFI30 (NP_006323, 1 a.a. ~ 250 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
Protein accession: NP_006323
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010437-B01P-13-15-1.jpg
Application image note: Western Blot analysis of IFI30 expression in transfected 293T cell line by IFI30 MaxPab polyclonal antibody.

Lane 1: IFI30 transfected lysate(27.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFI30 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart