CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00010435-D01P
Product name: CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CDC42EP2 protein.
Gene id: 10435
Gene name: CDC42EP2
Gene alias: BORG1|CEP2
Gene description: CDC42 effector protein (Rho GTPase binding) 2
Genbank accession: NM_006779.2
Immunogen: CDC42EP2 (NP_006770.1, 1 a.a. ~ 210 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
Protein accession: NP_006770.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010435-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CDC42EP2 expression in transfected 293T cell line (H00010435-T02) by CDC42EP2 MaxPab polyclonal antibody.

Lane 1: CDC42EP2 transfected lysate(22.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart