Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RBM14 monoclonal antibody (M01A), clone 4E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RBM14 monoclonal antibody (M01A), clone 4E1
| Brand: | Abnova |
| Reference: | H00010432-M01A |
| Product name: | RBM14 monoclonal antibody (M01A), clone 4E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM14. |
| Clone: | 4E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10432 |
| Gene name: | RBM14 |
| Gene alias: | COAA|DKFZp779J0927|MGC15912|MGC31756|PSP2|SIP|SYTIP1|TMEM137 |
| Gene description: | RNA binding motif protein 14 |
| Genbank accession: | BC000488 |
| Immunogen: | RBM14 (AAH00488, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQ |
| Protein accession: | AAH00488 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |