Brand: | Abnova |
Reference: | H00010428-M04 |
Product name: | CFDP1 monoclonal antibody (M04), clone 5B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CFDP1. |
Clone: | 5B7 |
Isotype: | IgG1 Kappa |
Gene id: | 10428 |
Gene name: | CFDP1 |
Gene alias: | BCNT|BUCENTAUR|CP27|SWC5|Yeti|p97 |
Gene description: | craniofacial development protein 1 |
Genbank accession: | NM_006324 |
Immunogen: | CFDP1 (NP_006315, 168 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESF |
Protein accession: | NP_006315 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |