Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PGRMC2 monoclonal antibody (M04), clone 3C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about PGRMC2 monoclonal antibody (M04), clone 3C11
| Brand: | Abnova |
| Reference: | H00010424-M04 |
| Product name: | PGRMC2 monoclonal antibody (M04), clone 3C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PGRMC2. |
| Clone: | 3C11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10424 |
| Gene name: | PGRMC2 |
| Gene alias: | DG6|PMBP |
| Gene description: | progesterone receptor membrane component 2 |
| Genbank accession: | NM_006320 |
| Immunogen: | PGRMC2 (NP_006311, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD |
| Protein accession: | NP_006311 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PGRMC2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Alterations in progesterone receptor membrane component 2 (PGRMC2) in the endometrium of macaques afflicted with advanced endometriosis.Keator CS, Mah K, Slayden OD. Mol Hum Reprod. 2012 Jun;18(6):308-19. Epub 2012 Feb 3. |