PGRMC2 monoclonal antibody (M03), clone 2A3 View larger

PGRMC2 monoclonal antibody (M03), clone 2A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGRMC2 monoclonal antibody (M03), clone 2A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PGRMC2 monoclonal antibody (M03), clone 2A3

Brand: Abnova
Reference: H00010424-M03
Product name: PGRMC2 monoclonal antibody (M03), clone 2A3
Product description: Mouse monoclonal antibody raised against a partial recombinant PGRMC2.
Clone: 2A3
Isotype: IgG1 Kappa
Gene id: 10424
Gene name: PGRMC2
Gene alias: DG6|PMBP
Gene description: progesterone receptor membrane component 2
Genbank accession: NM_006320
Immunogen: PGRMC2 (NP_006311, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Protein accession: NP_006311
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010424-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00010424-M03-1-1-1.jpg
Application image note: PGRMC2 monoclonal antibody (M03), clone 2A3. Western Blot analysis of PGRMC2 expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGRMC2 monoclonal antibody (M03), clone 2A3 now

Add to cart