TESK2 monoclonal antibody (M11), clone 5C3 View larger

TESK2 monoclonal antibody (M11), clone 5C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TESK2 monoclonal antibody (M11), clone 5C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TESK2 monoclonal antibody (M11), clone 5C3

Brand: Abnova
Reference: H00010420-M11
Product name: TESK2 monoclonal antibody (M11), clone 5C3
Product description: Mouse monoclonal antibody raised against a partial recombinant TESK2.
Clone: 5C3
Isotype: IgG1 Kappa
Gene id: 10420
Gene name: TESK2
Gene alias: -
Gene description: testis-specific kinase 2
Genbank accession: BC033085
Immunogen: TESK2 (AAH33085, 405 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPGTMPLADWQEPLAPPIRRWCSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG
Protein accession: AAH33085
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010420-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.81 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010420-M11-13-15-1.jpg
Application image note: Western Blot analysis of TESK2 expression in transfected 293T cell line by TESK2 monoclonal antibody (M11), clone 5C3.

Lane 1: TESK2 transfected lysate(60.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TESK2 monoclonal antibody (M11), clone 5C3 now

Add to cart