Brand: | Abnova |
Reference: | H00010413-M01A |
Product name: | YAP1 monoclonal antibody (M01A), clone 2F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant YAP1. |
Clone: | 2F12 |
Isotype: | IgG2a Kappa |
Gene id: | 10413 |
Gene name: | YAP1 |
Gene alias: | YAP|YAP2|YAP65|YKI |
Gene description: | Yes-associated protein 1, 65kDa |
Genbank accession: | NM_006106 |
Immunogen: | YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR |
Protein accession: | NP_006097 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |