Brand: | Abnova |
Reference: | H00010410-M02 |
Product name: | IFITM3 monoclonal antibody (M02), clone 2H4-1D5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IFITM3. |
Clone: | 2H4-1D5 |
Isotype: | IgG1 Kappa |
Gene id: | 10410 |
Gene name: | IFITM3 |
Gene alias: | 1-8U|IP15 |
Gene description: | interferon induced transmembrane protein 3 (1-8U) |
Genbank accession: | BC006794 |
Immunogen: | IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
Protein accession: | AAH06794 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IFITM3 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |