Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFITM3 monoclonal antibody (M01), clone 4C8-1B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about IFITM3 monoclonal antibody (M01), clone 4C8-1B10
| Brand: | Abnova |
| Reference: | H00010410-M01 |
| Product name: | IFITM3 monoclonal antibody (M01), clone 4C8-1B10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IFITM3. |
| Clone: | 4C8-1B10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10410 |
| Gene name: | IFITM3 |
| Gene alias: | 1-8U|IP15 |
| Gene description: | interferon induced transmembrane protein 3 (1-8U) |
| Genbank accession: | BC006794 |
| Immunogen: | IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
| Protein accession: | AAH06794 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IFITM3 monoclonal antibody (M01), clone 4C8-1B10 Western Blot analysis of IFITM3 expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Interactions between PBEF and oxidative stress proteins - A potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ. FEBS Lett. 2008 Jun 11;582(13):1802-8. Epub 2008 May 16. |