Cart 58 Product Products 18 952,37 € (empty)
No products
To be determined Shipping
18 952,37 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 58 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 952,37 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 952,37 €
Data sheet of IFITM3 purified MaxPab rabbit polyclonal antibody (D03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about IFITM3 purified MaxPab rabbit polyclonal antibody (D03P)
| Brand: | Abnova |
| Reference: | H00010410-D03P |
| Product name: | IFITM3 purified MaxPab rabbit polyclonal antibody (D03P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IFITM3 protein. |
| Gene id: | 10410 |
| Gene name: | IFITM3 |
| Gene alias: | 1-8U|IP15 |
| Gene description: | interferon induced transmembrane protein 3 (1-8U) |
| Genbank accession: | BC006794 |
| Immunogen: | IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
| Protein accession: | AAH06794 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T01) by IFITM3 MaxPab polyclonal antibody. Lane 1: IFITM3 transfected lysate(14.74 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |