Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00010410-B02P |
Product name: | IFITM3 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human IFITM3 protein. |
Gene id: | 10410 |
Gene name: | IFITM3 |
Gene alias: | 1-8U|IP15 |
Gene description: | interferon induced transmembrane protein 3 (1-8U) |
Genbank accession: | NM_021034.1 |
Immunogen: | IFITM3 (NP_066362.1, 1 a.a. ~ 133 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
Protein accession: | NP_066362.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T02) by IFITM3 MaxPab polyclonal antibody. Lane 1: IFITM3 transfected lysate(14.63 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |