IFITM3 polyclonal antibody (A01) View larger

IFITM3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFITM3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IFITM3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010410-A01
Product name: IFITM3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant IFITM3.
Gene id: 10410
Gene name: IFITM3
Gene alias: 1-8U|IP15
Gene description: interferon induced transmembrane protein 3 (1-8U)
Genbank accession: BC006794
Immunogen: IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Protein accession: AAH06794
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010410-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IFITM3 polyclonal antibody (A01) now

Add to cart