Brand: | Abnova |
Reference: | H00010406-P01 |
Product name: | WFDC2 (Human) Recombinant Protein (P01) |
Product description: | Human WFDC2 full-length ORF ( AAH46106.1, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 10406 |
Gene name: | WFDC2 |
Gene alias: | HE4|MGC57529|WAP5|dJ461P17.6 |
Gene description: | WAP four-disulfide core domain 2 |
Genbank accession: | BC046106 |
Immunogen sequence/protein sequence: | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF |
Protein accession: | AAH46106.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Selection of DNA aptamers for ovarian cancer biomarker HE4 using CE-SELEX and high-throughput sequencing.Eaton RM, Shallcross JA, Mael LE, Mears KS, Minkoff L, Scoville DJ, Whelan RJ Anal Bioanal Chem. 2015 Apr 12. |