PGCP monoclonal antibody (M06), clone 2F7 View larger

PGCP monoclonal antibody (M06), clone 2F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGCP monoclonal antibody (M06), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PGCP monoclonal antibody (M06), clone 2F7

Brand: Abnova
Reference: H00010404-M06
Product name: PGCP monoclonal antibody (M06), clone 2F7
Product description: Mouse monoclonal antibody raised against a full-length recombinant PGCP.
Clone: 2F7
Isotype: IgG2a Kappa
Gene id: 10404
Gene name: PGCP
Gene alias: -
Gene description: plasma glutamate carboxypeptidase
Genbank accession: BC020689
Immunogen: PGCP (AAH20689, 1 a.a. ~ 472 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS
Protein accession: AAH20689
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010404-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (77.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010404-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PGCP is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PGCP monoclonal antibody (M06), clone 2F7 now

Add to cart