H00010403-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010403-M01 |
Product name: | KNTC2 monoclonal antibody (M01), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KNTC2. |
Clone: | 1A10 |
Isotype: | IgG1 Kappa |
Gene id: | 10403 |
Gene name: | NDC80 |
Gene alias: | HEC|HEC1|KNTC2|TID3|hsNDC80 |
Gene description: | NDC80 homolog, kinetochore complex component (S. cerevisiae) |
Genbank accession: | BC035617 |
Immunogen: | KNTC2 (AAH35617, 545 a.a. ~ 642 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE |
Protein accession: | AAH35617 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | KNTC2 monoclonal antibody (M01), clone 1A10 Western Blot analysis of KNTC2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Proinvasion metastasis drivers in early-stage melanoma are oncogenes.Scott KL, Nogueira C, Heffernan TP, van Doorn R, Dhakal S, Hanna JA, Min C, Jaskelioff M, Xiao Y, Wu CJ, Cameron LA, Perry SR, Zeid R, Feinberg T, Kim M, Vande Woude G, Granter SR, Bosenberg M, Chu GC, Depinho RA, Rimm DL, Chin L. Cancer Cell. 2011 Jul 12;20(1):92-103. |