No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00010393-D01P |
Product name: | ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ANAPC10 protein. |
Gene id: | 10393 |
Gene name: | ANAPC10 |
Gene alias: | APC10|DKFZp564L0562|DOC1 |
Gene description: | anaphase promoting complex subunit 10 |
Genbank accession: | BC005217 |
Immunogen: | ANAPC10 (AAH05217.1, 1 a.a. ~ 185 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR |
Protein accession: | AAH05217.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ANAPC10 expression in transfected 293T cell line (H00010393-T02) by ANAPC10 MaxPab polyclonal antibody. Lane 1: ANAPC10 transfected lysate(21.30 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |