ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00010393-D01P
Product name: ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ANAPC10 protein.
Gene id: 10393
Gene name: ANAPC10
Gene alias: APC10|DKFZp564L0562|DOC1
Gene description: anaphase promoting complex subunit 10
Genbank accession: BC005217
Immunogen: ANAPC10 (AAH05217.1, 1 a.a. ~ 185 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Protein accession: AAH05217.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010393-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ANAPC10 expression in transfected 293T cell line (H00010393-T02) by ANAPC10 MaxPab polyclonal antibody.

Lane 1: ANAPC10 transfected lysate(21.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart