BPNT1 monoclonal antibody (M02), clone 3D4 View larger

BPNT1 monoclonal antibody (M02), clone 3D4

H00010380-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BPNT1 monoclonal antibody (M02), clone 3D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BPNT1 monoclonal antibody (M02), clone 3D4

Brand: Abnova
Reference: H00010380-M02
Product name: BPNT1 monoclonal antibody (M02), clone 3D4
Product description: Mouse monoclonal antibody raised against a partial recombinant BPNT1.
Clone: 3D4
Isotype: IgG1 Kappa
Gene id: 10380
Gene name: BPNT1
Gene alias: PIP
Gene description: 3'(2'), 5'-bisphosphate nucleotidase 1
Genbank accession: NM_006085
Immunogen: BPNT1 (NP_006076, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC
Protein accession: NP_006076
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010380-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010380-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged BPNT1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BPNT1 monoclonal antibody (M02), clone 3D4 now

Add to cart