BPNT1 monoclonal antibody (M01), clone 2E1 View larger

BPNT1 monoclonal antibody (M01), clone 2E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BPNT1 monoclonal antibody (M01), clone 2E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about BPNT1 monoclonal antibody (M01), clone 2E1

Brand: Abnova
Reference: H00010380-M01
Product name: BPNT1 monoclonal antibody (M01), clone 2E1
Product description: Mouse monoclonal antibody raised against a partial recombinant BPNT1.
Clone: 2E1
Isotype: IgG1 Kappa
Gene id: 10380
Gene name: BPNT1
Gene alias: PIP
Gene description: 3'(2'), 5'-bisphosphate nucleotidase 1
Genbank accession: NM_006085
Immunogen: BPNT1 (NP_006076, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC
Protein accession: NP_006076
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010380-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010380-M01-3-38-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BPNT1 monoclonal antibody (M01), clone 2E1 now

Add to cart