Brand: | Abnova |
Reference: | H00010368-M01 |
Product name: | CACNG3 monoclonal antibody (M01), clone 3E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNG3. |
Clone: | 3E4 |
Isotype: | IgG1 Kappa |
Gene id: | 10368 |
Gene name: | CACNG3 |
Gene alias: | Cacng2 |
Gene description: | calcium channel, voltage-dependent, gamma subunit 3 |
Genbank accession: | NM_006539 |
Immunogen: | CACNG3 (NP_006530, 199 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK |
Protein accession: | NP_006530 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | CACNG3 monoclonal antibody (M01), clone 3E4 Western Blot analysis of CACNG3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |