Brand: | Abnova |
Reference: | H00010360-M02 |
Product name: | NPM3 monoclonal antibody (M02), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NPM3. |
Clone: | 3F2 |
Isotype: | IgG2a Kappa |
Gene id: | 10360 |
Gene name: | NPM3 |
Gene alias: | PORMIN|TMEM123 |
Gene description: | nucleophosmin/nucleoplasmin, 3 |
Genbank accession: | NM_006993 |
Immunogen: | NPM3 (NP_008924.1, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV |
Protein accession: | NP_008924.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |