WARS2 monoclonal antibody (M01), clone 3D8 View larger

WARS2 monoclonal antibody (M01), clone 3D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WARS2 monoclonal antibody (M01), clone 3D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about WARS2 monoclonal antibody (M01), clone 3D8

Brand: Abnova
Reference: H00010352-M01
Product name: WARS2 monoclonal antibody (M01), clone 3D8
Product description: Mouse monoclonal antibody raised against a partial recombinant WARS2.
Clone: 3D8
Isotype: IgG2a Kappa
Gene id: 10352
Gene name: WARS2
Gene alias: TrpRS
Gene description: tryptophanyl tRNA synthetase 2, mitochondrial
Genbank accession: NM_015836
Immunogen: WARS2 (NP_056651.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQ
Protein accession: NP_056651.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy WARS2 monoclonal antibody (M01), clone 3D8 now

Add to cart