TLR6 monoclonal antibody (M01), clone 4E4 View larger

TLR6 monoclonal antibody (M01), clone 4E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR6 monoclonal antibody (M01), clone 4E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TLR6 monoclonal antibody (M01), clone 4E4

Brand: Abnova
Reference: H00010333-M01
Product name: TLR6 monoclonal antibody (M01), clone 4E4
Product description: Mouse monoclonal antibody raised against a partial recombinant TLR6.
Clone: 4E4
Isotype: IgG2a Kappa
Gene id: 10333
Gene name: TLR6
Gene alias: CD286
Gene description: toll-like receptor 6
Genbank accession: NM_006068
Immunogen: TLR6 (NP_006059, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
Protein accession: NP_006059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010333-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TLR6 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TLR6 monoclonal antibody (M01), clone 4E4 now

Add to cart