Brand: | Abnova |
Reference: | H00010331-M01 |
Product name: | B3GNT3 monoclonal antibody (M01), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant B3GNT3. |
Clone: | 1A2 |
Isotype: | IgG2a Kappa |
Gene id: | 10331 |
Gene name: | B3GNT3 |
Gene alias: | B3GAL-T8|B3GN-T3|B3GNT-3|HP10328|TMEM3|beta3Gn-T3 |
Gene description: | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 |
Genbank accession: | NM_014256 |
Immunogen: | B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN |
Protein accession: | NP_055071 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged B3GNT3 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |