Brand: | Abnova |
Reference: | H00010328-M01 |
Product name: | COX4NB monoclonal antibody (M01), clone 4F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COX4NB. |
Clone: | 4F4 |
Isotype: | IgG2a Kappa |
Gene id: | 10328 |
Gene name: | COX4NB |
Gene alias: | C16orf2|C16orf4|FAM158B|NOC4 |
Gene description: | COX4 neighbor |
Genbank accession: | NM_006067 |
Immunogen: | COX4NB (NP_006058.1, 113 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC |
Protein accession: | NP_006058.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged COX4NB is 0.3 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |