Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TCIRG1 monoclonal antibody (M02), clone 7H20
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TCIRG1 monoclonal antibody (M02), clone 7H20
| Brand: | Abnova |
| Reference: | H00010312-M02 |
| Product name: | TCIRG1 monoclonal antibody (M02), clone 7H20 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TCIRG1. |
| Clone: | 7H20 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10312 |
| Gene name: | TCIRG1 |
| Gene alias: | ATP6N1C|ATP6V0A3|Atp6i|OC-116kDa|OC116|OPTB1|Stv1|TIRC7|Vph1|a3 |
| Gene description: | T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 |
| Genbank accession: | BC018133 |
| Immunogen: | TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL |
| Protein accession: | AAH18133 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A comparison of osteoclast-rich and osteoclast-poor osteopetrosis in adult mice sheds light on the role of the osteoclast in coupling bone resorption and bone formation.Thudium CS, Moscatelli I, Flores C, Thomsen JS, Bruel A, Gudmann NS, Hauge EM, Karsdal MA, Richter J, Henriksen K Calcif Tissue Int. 2014 Jul;95(1):83-93. doi: 10.1007/s00223-014-9865-4. Epub 2014 May 18. |