Brand: | Abnova |
Reference: | H00010301-M02 |
Product name: | DLEU1 monoclonal antibody (M02), clone 2C2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DLEU1. |
Clone: | 2C2 |
Isotype: | IgG1 Kappa |
Gene id: | 10301 |
Gene name: | DLEU1 |
Gene alias: | BCMS|DLB1|DLEU2|LEU1|LEU2|MGC22430|NCRNA00021|XTP6 |
Gene description: | deleted in lymphocytic leukemia 1 (non-protein coding) |
Genbank accession: | BC020692 |
Immunogen: | DLEU1 (AAH20692, 1 a.a. ~ 78 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY |
Protein accession: | AAH20692 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.32 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DLEU1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |