Brand: | Abnova |
Reference: | H00010299-M05 |
Product name: | MARCH6 monoclonal antibody (M05), clone 1A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MARCH6. |
Clone: | 1A5 |
Isotype: | IgG2b Kappa |
Gene id: | 10299 |
Gene name: | MARCH6 |
Gene alias: | KIAA0597|MARCH-VI|RNF176|TEB4 |
Gene description: | membrane-associated ring finger (C3HC4) 6 |
Genbank accession: | NM_005885 |
Immunogen: | MARCH6 (NP_005876, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR |
Protein accession: | NP_005876 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |