PAK4 monoclonal antibody (M01), clone 3F10 View larger

PAK4 monoclonal antibody (M01), clone 3F10

H00010298-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAK4 monoclonal antibody (M01), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PAK4 monoclonal antibody (M01), clone 3F10

Brand: Abnova
Reference: H00010298-M01
Product name: PAK4 monoclonal antibody (M01), clone 3F10
Product description: Mouse monoclonal antibody raised against a partial recombinant PAK4.
Clone: 3F10
Isotype: IgG1 Kappa
Gene id: 10298
Gene name: PAK4
Gene alias: -
Gene description: p21 protein (Cdc42/Rac)-activated kinase 4
Genbank accession: BC002921
Immunogen: PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD
Protein accession: AAH02921
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010298-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged PAK4 is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PAK4 monoclonal antibody (M01), clone 3F10 now

Add to cart