Brand: | Abnova |
Reference: | H00010298-M01 |
Product name: | PAK4 monoclonal antibody (M01), clone 3F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAK4. |
Clone: | 3F10 |
Isotype: | IgG1 Kappa |
Gene id: | 10298 |
Gene name: | PAK4 |
Gene alias: | - |
Gene description: | p21 protein (Cdc42/Rac)-activated kinase 4 |
Genbank accession: | BC002921 |
Immunogen: | PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD |
Protein accession: | AAH02921 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged PAK4 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |