Brand: | Abnova |
Reference: | H00010249-M07 |
Product name: | GLYAT monoclonal antibody (M07), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GLYAT. |
Clone: | 1A10 |
Isotype: | IgG2a Kappa |
Gene id: | 10249 |
Gene name: | GLYAT |
Gene alias: | ACGNAT|CAT|GAT |
Gene description: | glycine-N-acyltransferase |
Genbank accession: | NM_201648 |
Immunogen: | GLYAT (NP_964011.1, 64 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAI |
Protein accession: | NP_964011.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to GLYAT on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |