GLYAT monoclonal antibody (M07), clone 1A10 View larger

GLYAT monoclonal antibody (M07), clone 1A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLYAT monoclonal antibody (M07), clone 1A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about GLYAT monoclonal antibody (M07), clone 1A10

Brand: Abnova
Reference: H00010249-M07
Product name: GLYAT monoclonal antibody (M07), clone 1A10
Product description: Mouse monoclonal antibody raised against a partial recombinant GLYAT.
Clone: 1A10
Isotype: IgG2a Kappa
Gene id: 10249
Gene name: GLYAT
Gene alias: ACGNAT|CAT|GAT
Gene description: glycine-N-acyltransferase
Genbank accession: NM_201648
Immunogen: GLYAT (NP_964011.1, 64 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAI
Protein accession: NP_964011.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010249-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010249-M07-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GLYAT on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GLYAT monoclonal antibody (M07), clone 1A10 now

Add to cart